SCOPe 2.07: Domain d4lnua2: 4lnu A:246-437

Lineage for d4lnua2 (4lnu A:246-437)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [226224] (26 PDB entries)

8. Domain d4lnua2: 4lnu A:246-437 [261346]
   Other proteins in same PDB: d4lnua1, d4lnub1, d4lnud_
   automated match to d4i50a2
   complexed with gdp, gol, gtp, mes, mg, so4

Details for d4lnua2

PDB Entry: 4lnu, 2.19 Å

PDB Description: Nucleotide-free kinesin motor domain in complex with tubulin and a DARPin

PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d4lnua2:

Sequence; same for both SEQRES and ATOM records:

>d4lnua2 d.79.2.1 (A:246-437) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

Timeline for d4lnua2:

• d4lnua2 first appeared in SCOPe 2.04
  
• d4lnua2 appears in SCOPe 2.06
  
• d4lnua2 appears in the current release, SCOPe 2.08