Lineage for d4lnua1 (4lnu A:1-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107851Protein automated matches [226837] (7 species)
    not a true protein
  7. 2107925Species Sheep (Ovis aries) [TaxId:9940] [224884] (13 PDB entries)
  8. 2107938Domain d4lnua1: 4lnu A:1-245 [261345]
    Other proteins in same PDB: d4lnua2, d4lnub2, d4lnud_
    automated match to d4ihja1
    complexed with gdp, gol, gtp, mes, mg, so4

Details for d4lnua1

PDB Entry: 4lnu (more details), 2.19 Å

PDB Description: Nucleotide-free kinesin motor domain in complex with tubulin and a DARPin
PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d4lnua1:

Sequence, based on SEQRES records: (download)

>d4lnua1 c.32.1.1 (A:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Sequence, based on observed residues (ATOM records): (download)

>d4lnua1 c.32.1.1 (A:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktgddsfntffsetgagkhvp
ravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrir
kladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavve
pynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssitaslr
fd

SCOPe Domain Coordinates for d4lnua1:

Click to download the PDB-style file with coordinates for d4lnua1.
(The format of our PDB-style files is described here.)

Timeline for d4lnua1: