SCOPe 2.08: Domain d4wwla2: 4wwl A:363-550

Lineage for d4wwla2 (4wwl A:363-550)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
   core: alpha-beta(2)-alpha-beta(2)-alpha-beta; 3 layers; mixed sheet: order 31425

4. Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (2 families)

5. Family d.114.1.0: automated matches [261326] (1 protein)
   not a true family

6. Protein automated matches [261327] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [261328] (1 PDB entry)

8. Domain d4wwla2: 4wwl A:363-550 [261329]
   Other proteins in same PDB: d4wwla1
   automated match to d1hp1a1
   complexed with co3, gol, mtn, so4, zn; mutant

Details for d4wwla2

PDB Entry: 4wwl, 2.23 Å

PDB Description: e. coli 5'-nucleotidase mutant i521c labeled with mtsl (intermediate form)

PDB Compounds: (A:) protein usha

SCOPe Domain Sequences for d4wwla2:

Sequence; same for both SEQRES and ATOM records:

>d4wwla2 d.114.1.0 (A:363-550) automated matches {Escherichia coli [TaxId: 83333]}
kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn
vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakdgklndlkikg
epvdpaktyrmatlnfnatggdgyprldnkpgyvntgfcdaevlkayiqksspldvsvye
pkgevswq

Timeline for d4wwla2:

• d4wwla2 first appeared in SCOPe 2.04
  
• d4wwla2 appears in SCOPe 2.07