Lineage for d4wuia1 (4wui A:1-204)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827466Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2827467Protein automated matches [190292] (36 species)
    not a true protein
  7. 2827575Species Jonesia denitrificans [TaxId:471856] [261320] (1 PDB entry)
  8. 2827576Domain d4wuia1: 4wui A:1-204 [261321]
    Other proteins in same PDB: d4wuia2
    automated match to d4aaja_
    complexed with cit

Details for d4wuia1

PDB Entry: 4wui (more details), 1.09 Å

PDB Description: crystal structure of trpf from jonesia denitrificans
PDB Compounds: (A:) n-(5'-phosphoribosyl)anthranilate isomerase

SCOPe Domain Sequences for d4wuia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wuia1 c.1.2.0 (A:1-204) automated matches {Jonesia denitrificans [TaxId: 471856]}
myikvcgltdphaidaaqaahvdaigfvhaptsprhltpphistltatvdctidtvlvva
ttpiadalalaestgvsvlqlhgqysdddvayaaarfprvwratslsaspnltvgaygee
lllldapqagsghtwdfaalahrrptgrwllaggltpdnvadaitttspwgvdvssgves
apgvkdpakiaafvqaargvscpr

SCOPe Domain Coordinates for d4wuia1:

Click to download the PDB-style file with coordinates for d4wuia1.
(The format of our PDB-style files is described here.)

Timeline for d4wuia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wuia2