SCOPe 2.08: Domain d4wnqa2: 4wnq A:126-214

Lineage for d4wnqa2 (4wnq A:126-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4wnqa2: 4wnq A:126-214 [261318]
   Other proteins in same PDB: d4wnqa1, d4wnqb1, d4wnqc1, d4wnqd1
   automated match to d2f54d2

Details for d4wnqa2

PDB Entry: 4wnq, 1.8 Å

PDB Description: the molecular bases of delta/alpha-beta t-cell mediated antigen recognition

PDB Compounds: (A:) TCR Variable Delta 1 chain and TCR constant Alpha chain

SCOPe Domain Sequences for d4wnqa2:

Sequence; same for both SEQRES and ATOM records:

>d4wnqa2 b.1.1.2 (A:126-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d4wnqa2:

• d4wnqa2 first appeared in SCOPe 2.04
  
• d4wnqa2 appears in SCOPe 2.07