Lineage for d4wnqb2 (4wnq B:126-253)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750092Domain d4wnqb2: 4wnq B:126-253 [261316]
    Other proteins in same PDB: d4wnqa1, d4wnqb1, d4wnqc1, d4wnqd1
    automated match to d3of6b2

Details for d4wnqb2

PDB Entry: 4wnq (more details), 1.8 Å

PDB Description: the molecular bases of delta/alpha-beta t-cell mediated antigen recognition
PDB Compounds: (B:) TCR Variable Beta 2 (TRBV20) chain and TCR constant Beta chain

SCOPe Domain Sequences for d4wnqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wnqb2 b.1.1.2 (B:126-253) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

SCOPe Domain Coordinates for d4wnqb2:

Click to download the PDB-style file with coordinates for d4wnqb2.
(The format of our PDB-style files is described here.)

Timeline for d4wnqb2: