Lineage for d4v0na1 (4v0n A:16-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872010Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [255698] (6 PDB entries)
  8. 2872019Domain d4v0na1: 4v0n A:16-180 [261302]
    Other proteins in same PDB: d4v0na2, d4v0nc2, d4v0ne2, d4v0ng2
    automated match to d2gaoa1
    complexed with gtp, hg, mg

Details for d4v0na1

PDB Entry: 4v0n (more details), 3.13 Å

PDB Description: crystal structure of bbs1n in complex with arl6dn, soaked with mercury
PDB Compounds: (A:) arf-like small gtpase

SCOPe Domain Sequences for d4v0na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v0na1 c.37.1.0 (A:16-180) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
kkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdmsgagr
yrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkdlpva
mppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls

SCOPe Domain Coordinates for d4v0na1:

Click to download the PDB-style file with coordinates for d4v0na1.
(The format of our PDB-style files is described here.)

Timeline for d4v0na1: