Lineage for d4uvra_ (4uvr A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1499255Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1499256Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1499814Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1499815Protein automated matches [190847] (40 species)
    not a true protein
  7. 1500202Species Trypanosoma cruzi [TaxId:5693] [196511] (9 PDB entries)
  8. 1500209Domain d4uvra_: 4uvr A: [261301]
    automated match to d3khma_
    complexed with hem, j5y, so4

Details for d4uvra_

PDB Entry: 4uvr (more details), 2.48 Å

PDB Description: Binding mode, selectivity and potency of N-indolyl-oxopyridinyl-4- amino-propanyl-based inhibitors targeting Trypanosoma cruzi CYP51
PDB Compounds: (A:) sterol 14-demethylase, cyp51

SCOPe Domain Sequences for d4uvra_:

Sequence, based on SEQRES records: (download)

>d4uvra_ a.104.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
gklppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsr
ffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
evrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmessl
ipaavfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllka
vyrdgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpa
qlnydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllsh
hdeeafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqll
rdevpdpdyhtmvvgptlnqclvkytrk

Sequence, based on observed residues (ATOM records): (download)

>d4uvra_ a.104.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
gklppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsr
ffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
evrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmessl
ipaavfmpwllrlplpqsarcrearaelqkilgeiivareksdllggllkavyrdgtrms
lhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqlnydnvmd
empfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhdeeafpnp
rlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrdevpdpdy
htmvvgptlnqclvkytrk

SCOPe Domain Coordinates for d4uvra_:

Click to download the PDB-style file with coordinates for d4uvra_.
(The format of our PDB-style files is described here.)

Timeline for d4uvra_:

  • d4uvra_ appears in periodic updates to SCOPe 2.04 starting on 2014-12-01
  • d4uvra_ appears in SCOPe 2.05
  • d4uvra_ appears in the current release, SCOPe 2.07, called d4uvra1