Lineage for d4uvra1 (4uvr A:32-476)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005985Species Trypanosoma cruzi [TaxId:5693] [196511] (10 PDB entries)
  8. 2005994Domain d4uvra1: 4uvr A:32-476 [261301]
    Other proteins in same PDB: d4uvra2
    automated match to d3khma_
    complexed with hem, j5y, so4

Details for d4uvra1

PDB Entry: 4uvr (more details), 2.48 Å

PDB Description: Binding mode, selectivity and potency of N-indolyl-oxopyridinyl-4- amino-propanyl-based inhibitors targeting Trypanosoma cruzi CYP51
PDB Compounds: (A:) sterol 14-demethylase, cyp51

SCOPe Domain Sequences for d4uvra1:

Sequence, based on SEQRES records: (download)

>d4uvra1 a.104.1.0 (A:32-476) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrffs
prneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhevr
kfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmesslipa
avfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllkavyr
dgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqln
ydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhde
eafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrde
vpdpdyhtmvvgptlnqclvkytrk

Sequence, based on observed residues (ATOM records): (download)

>d4uvra1 a.104.1.0 (A:32-476) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrffs
prneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhevr
kfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmesslipa
avfmpwllrlplpqsarcrearaelqkilgeiivareksdllggllkavyrdgtrmslhe
vcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqlnydnvmdemp
faercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhdeeafpnprlw
dperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrdevpdpdyhtm
vvgptlnqclvkytrk

SCOPe Domain Coordinates for d4uvra1:

Click to download the PDB-style file with coordinates for d4uvra1.
(The format of our PDB-style files is described here.)

Timeline for d4uvra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4uvra2