Lineage for d4um4a_ (4um4 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1789893Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 1789894Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 1789895Protein Inorganic pyrophosphatase [50326] (7 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 1789935Species Escherichia coli [TaxId:562] [50329] (19 PDB entries)
  8. 1789962Domain d4um4a_: 4um4 A: [261297]
    automated match to d1jfda_
    complexed with so4

Details for d4um4a_

PDB Entry: 4um4 (more details), 2.65 Å

PDB Description: structure of inorganic pyrophosphatase from escherichia coli in complex with sulfate
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d4um4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4um4a_ b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk

SCOPe Domain Coordinates for d4um4a_:

Click to download the PDB-style file with coordinates for d4um4a_.
(The format of our PDB-style files is described here.)

Timeline for d4um4a_: