SCOPe 2.05: Domain d4ubga_: 4ubg A:

Lineage for d4ubga_ (4ubg A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
   Pfam PF05995, CDO_I

6. Protein Cysteine dioxygenase type I [141616] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (21 PDB entries)

8. Domain d4ubga_: 4ubg A: [261296]
   automated match to d3elna_
   complexed with fe2, na

Details for d4ubga_

PDB Entry: 4ubg, 1.9 Å

PDB Description: resting state of rat cysteine dioxygenase c93g variant

PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d4ubga_:

Sequence; same for both SEQRES and ATOM records:

>d4ubga_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlv
dqgngkfnlmilcwgeghgssihdhtdshgflkllqgnlketlfdwpdkksnemikkser
tlrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhs
kfgirtp

Timeline for d4ubga_:

• d4ubga_ first appeared in SCOPe 2.04
  
• d4ubga_ appears in SCOPe 2.06
  
• d4ubga_ appears in the current release, SCOPe 2.08