Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
Protein automated matches [191209] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189839] (61 PDB entries) |
Domain d4tw6a1: 4tw6 A:16-140 [261294] Other proteins in same PDB: d4tw6a2 automated match to d3o5qa_ complexed with 37l, gol, na |
PDB Entry: 4tw6 (more details), 1.4 Å
SCOPe Domain Sequences for d4tw6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tw6a1 d.26.1.1 (A:16-140) automated matches {Human (Homo sapiens) [TaxId: 9606]} atvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshdrne pfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffeiell dfkge
Timeline for d4tw6a1: