Lineage for d4rqbb_ (4rqb B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892105Species Staphylococcus aureus [TaxId:451516] [261285] (2 PDB entries)
  8. 2892108Domain d4rqbb_: 4rqb B: [261287]
    automated match to d3kb8b_
    complexed with cl, gol, so4, unl

Details for d4rqbb_

PDB Entry: 4rqb (more details), 2.45 Å

PDB Description: Crystal Structure of a Hypoxanthine Phosphoribosyltransferase (target ID NYSGRC-029686) from Staphylococcus aureus (tetragonal space group)
PDB Compounds: (B:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4rqbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rqbb_ c.61.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 451516]}
vmhndlkevllteediqnickelgaqltkdyqgkplvcvgilkgsamfmsdlikridthl
sidfmdvssyhggtestgevqiikdlgssienkdvliiediletgttlksitellqsrkv
nsleivtlldkpnrrkadieakyvgkkipdefvvgygldyrelyrnlpyigtlkpevy

SCOPe Domain Coordinates for d4rqbb_:

Click to download the PDB-style file with coordinates for d4rqbb_.
(The format of our PDB-style files is described here.)

Timeline for d4rqbb_: