Lineage for d4rnla_ (4rnl A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2782125Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2782126Protein automated matches [226849] (8 species)
    not a true protein
  7. 2782246Species Streptomyces platensis [TaxId:58346] [261282] (1 PDB entry)
  8. 2782247Domain d4rnla_: 4rnl A: [261283]
    automated match to d1so0b_
    complexed with gol, po4

Details for d4rnla_

PDB Entry: 4rnl (more details), 1.8 Å

PDB Description: the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus
PDB Compounds: (A:) possible galactose mutarotase

SCOPe Domain Sequences for d4rnla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rnla_ b.30.5.0 (A:) automated matches {Streptomyces platensis [TaxId: 58346]}
amrtqvsrepfgtlddgtrvdrwtlesgpaglrvrvltyggivqtveapdrdgmrgqlal
gfadlasyaahggsyfgalvgryanriagasfvldgrtdaltpnngrhslhggpggfsrv
vwdarevdggvqlhrvspdgeegfpgaldvrvtytlsagalrivscattdaptvvnltnh
tylnlggdgsgsaaghelrlaasrytpvdgtgipvpgapaevtgtrfdfraaravagayd
hnfaldggvreaprtvaelydprsgralalattepglqlytadhldgtltgtsgvpygpa
aglaletqhfpdspnrpdfpstvlrpgesyrsetvyafsvr

SCOPe Domain Coordinates for d4rnla_:

Click to download the PDB-style file with coordinates for d4rnla_.
(The format of our PDB-style files is described here.)

Timeline for d4rnla_: