SCOPe 2.05: Domain d4rbpk2: 4rbp K:108-213

Lineage for d4rbpk2 (4rbp K:108-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4rbpk2: 4rbp K:108-213 [261277]
   Other proteins in same PDB: d4rbpk1, d4rbpl1
   automated match to d2f5al2
   complexed with gol

Details for d4rbpk2

PDB Entry: 4rbp, 1.85 Å

PDB Description: crystal structure of hiv neutralizing antibody 2g12 in complex with a bacterial oligosaccharide analog of mammalian oligomanose

PDB Compounds: (K:) Fab 2G12 light chain

SCOPe Domain Sequences for d4rbpk2:

Sequence; same for both SEQRES and ATOM records:

>d4rbpk2 b.1.1.2 (K:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4rbpk2:

• d4rbpk2 first appeared in SCOPe 2.04
  
• d4rbpk2 appears in SCOPe 2.06
  
• d4rbpk2 appears in the current release, SCOPe 2.08