SCOPe 2.08: Domain d4rbpk1: 4rbp K:1-107

Lineage for d4rbpk1 (4rbp K:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4rbpk1: 4rbp K:1-107 [261276]
   Other proteins in same PDB: d4rbpk2, d4rbpl2
   automated match to d1tjgl1
   complexed with gol

Details for d4rbpk1

PDB Entry: 4rbp, 1.85 Å

PDB Description: crystal structure of hiv neutralizing antibody 2g12 in complex with a bacterial oligosaccharide analog of mammalian oligomanose

PDB Compounds: (K:) Fab 2G12 light chain

SCOPe Domain Sequences for d4rbpk1:

Sequence; same for both SEQRES and ATOM records:

>d4rbpk1 b.1.1.0 (K:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveik

Timeline for d4rbpk1:

• d4rbpk1 first appeared in SCOPe 2.04
  
• d4rbpk1 appears in SCOPe 2.07