Lineage for d4qwwc1 (4qww C:1-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760566Domain d4qwwc1: 4qww C:1-109 [261274]
    Other proteins in same PDB: d4qwwa_, d4qwwb_, d4qwwd_, d4qwwe2, d4qwwf_
    automated match to d2fbjl1
    complexed with edo, nag

Details for d4qwwc1

PDB Entry: 4qww (more details), 2.7 Å

PDB Description: crystal structure of the fab410-bfache complex
PDB Compounds: (C:) Fab410 antibody light chain

SCOPe Domain Sequences for d4qwwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwwc1 b.1.1.0 (C:1-109) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivltqspaimsaspgekvtmtcsasssvsymywyhqkpgsspkpwiyrtsnlasgvpar
fsgsgsgtsyslsvssveaedaatyycqqynshpmtfgggtkleikrad

SCOPe Domain Coordinates for d4qwwc1:

Click to download the PDB-style file with coordinates for d4qwwc1.
(The format of our PDB-style files is described here.)

Timeline for d4qwwc1: