SCOPe 2.08: Domain d4qwwe2: 4qww E:110-212

Lineage for d4qwwe2 (4qww E:110-212)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d4qwwe2: 4qww E:110-212 [261273]
Other proteins in same PDB: d4qwwa_, d4qwwb_, d4qwwc1, d4qwwd_, d4qwwe1, d4qwwf_
automated match to d2fbjl2
complexed with edo, nag

Details for d4qwwe2

PDB Entry: 4qww (more details), 2.7 Å

PDB Description: crystal structure of the fab410-bfache complex

PDB Compounds: (E:) Fab410 antibody light chain

SCOPe Domain Sequences for d4qwwe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwwe2 b.1.1.2 (E:110-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4qwwe2:

Click to download the PDB-style file with coordinates for d4qwwe2.
(The format of our PDB-style files is described here.)

Timeline for d4qwwe2: