SCOPe 2.08: Domain d4qwwe1: 4qww E:1-109

Lineage for d4qwwe1 (4qww E:1-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4qwwe1: 4qww E:1-109 [261272]
   Other proteins in same PDB: d4qwwa_, d4qwwb_, d4qwwd_, d4qwwe2, d4qwwf_
   automated match to d2fbjl1
   complexed with edo, nag

Details for d4qwwe1

PDB Entry: 4qww, 2.7 Å

PDB Description: crystal structure of the fab410-bfache complex

PDB Compounds: (E:) Fab410 antibody light chain

SCOPe Domain Sequences for d4qwwe1:

Sequence; same for both SEQRES and ATOM records:

>d4qwwe1 b.1.1.0 (E:1-109) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivltqspaimsaspgekvtmtcsasssvsymywyhqkpgsspkpwiyrtsnlasgvpar
fsgsgsgtsyslsvssveaedaatyycqqynshpmtfgggtkleikrad

Timeline for d4qwwe1:

• d4qwwe1 first appeared in SCOPe 2.04
  
• d4qwwe1 appears in SCOPe 2.07