SCOPe 2.07: Domain d4rawa1: 4raw A:31-270

Lineage for d4rawa1 (4raw A:31-270)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)

8. Domain d4rawa1: 4raw A:31-270 [261268]
   Other proteins in same PDB: d4rawa2, d4rawb2
   automated match to d4hl2a_
   complexed with cd, edo, zz7; mutant

Details for d4rawa1

PDB Entry: 4raw, 1.3 Å

PDB Description: Crystal Structure of New Delhi Metallo-beta-Lactamase-1 Mutant M67V Complexed with Hydrolyzed Ampicillin

PDB Compounds: (A:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4rawa1:

Sequence; same for both SEQRES and ATOM records:

>d4rawa1 d.157.1.0 (A:31-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
irptigqqmetgdqrfgdlvfrqlapnvwqhtsyldvpgfgavasnglivrdggrvlvvd
tawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlap
qegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcli
kdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d4rawa1:

• d4rawa1 first appeared in SCOPe 2.04, called d4rawa_
  
• d4rawa1 appears in SCOPe 2.06
  
• d4rawa1 appears in the current release, SCOPe 2.08