Lineage for d4qwwb_ (4qww B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2899461Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2899847Protein automated matches [190065] (7 species)
    not a true protein
  7. 2899850Species Banded krait (Bungarus fasciatus) [TaxId:8613] [261265] (1 PDB entry)
  8. 2899852Domain d4qwwb_: 4qww B: [261266]
    Other proteins in same PDB: d4qwwc1, d4qwwd_, d4qwwe1, d4qwwe2, d4qwwf_
    automated match to d3i6ma_
    complexed with edo, nag

Details for d4qwwb_

PDB Entry: 4qww (more details), 2.7 Å

PDB Description: crystal structure of the fab410-bfache complex
PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d4qwwb_:

Sequence, based on SEQRES records: (download)

>d4qwwb_ c.69.1.1 (B:) automated matches {Banded krait (Bungarus fasciatus) [TaxId: 8613]}
agelkvstqtgsvrglslpvldghvsaflgipfaepplgrmrflrpepvkpwqhvldats
ykpacyqmvdtsypgfqgtemwnpnrgmsedclylniwvpsprpkdapvlvwiygggfys
gaasldvydgrfltytqnvilvslsyrvgafgflglpgspeapgnmglldqrlalqwiqn
nihpfggnpravtvfgesagaasvgmhllstqsrtlfqrailqsggpnapwatvtpaesr
graallgkqlgchfnndselvsclrsknpqelideewsvlpyksifrfpfvpvidgdffp
dtpeamlssgnfketqvllgvvkdegsyfliyglpgfskdneslisradflegvrmsvph
andiatdavvlqytdwqdqdnreknrealddivgdhnvicpvvqfandyakrnskvyayl
fdhrasnllwppwmgvphgyeiefvfglplndslnytpqekelsrrmmrywanfartgnp
tdpadksgawptytasqpqyvqlntqplatqpslraqicafwnhflpkllnat

Sequence, based on observed residues (ATOM records): (download)

>d4qwwb_ c.69.1.1 (B:) automated matches {Banded krait (Bungarus fasciatus) [TaxId: 8613]}
agelkvstqtgsvrglslpvldghvsaflgipfaepplgrmrflrpepvkpwqhvldats
ykpacyqmvdtsypgfqgtemwnpnrgmsedclylniwvpsprpkdapvlvwiygggfys
gaasldvydgrfltytqnvilvslsyrvgafgflglpgspeapgnmglldqrlalqwiqn
nihpfggnpravtvfgesagaasvgmhllstqsrtlfqrailqsggpnapwatvtpaesr
graallgkqlgchfnndselvsclrsknpqelideewsvlpyksifrfpfvpvidgdffp
dtpeamlssgnfketqvllgvvkdegsyfliyglpgfskdneslisradflegvrmsvph
andiatdavvlqytdwqdqdnreknrealddivgdhnvicpvvqfandyakrnskvyayl
fdhrasnllwppwmgvphgyeiefvfglplndslnytpqekelsrrmmrywanfartgnp
tdpaawptytasqpqyvqlntqplatqpslraqicafwnhflpkllnat

SCOPe Domain Coordinates for d4qwwb_:

Click to download the PDB-style file with coordinates for d4qwwb_.
(The format of our PDB-style files is described here.)

Timeline for d4qwwb_: