SCOPe 2.06: Domain d4qlgb_: 4qlg B:

Lineage for d4qlgb_ (4qlg B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)

7. Species Escherichia coli [TaxId:562] [53600] (79 PDB entries)

8. Domain d4qlgb_: 4qlg B: [261261]
   automated match to d3k74a_
   complexed with fol, nap; mutant

Details for d4qlgb_

PDB Entry: 4qlg, 1.5 Å

PDB Description: Crystal structure of I14V DHFR mutant complexed with folate and NADP+

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d4qlgb_:

Sequence; same for both SEQRES and ATOM records:

>d4qlgb_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvvgmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d4qlgb_:

• d4qlgb_ first appeared in SCOPe 2.04
  
• d4qlgb_ appears in SCOPe 2.05
  
• d4qlgb_ appears in SCOPe 2.07
  
• d4qlgb_ appears in the current release, SCOPe 2.08