SCOPe 2.04: Domain d4q2od_: 4q2o D:

Lineage for d4q2od_ (4q2o D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (36 PDB entries)

8. Domain d4q2od_: 4q2o D: [261254]
   automated match to d2eega_

Details for d4q2od_

PDB Entry: 4q2o, 2.1 Å

PDB Description: PDLIM4 PDZ in Complex with a Phage-Derived Peptide

PDB Compounds: (D:) pdz and lim domain protein 4

SCOPe Domain Sequences for d4q2od_:

Sequence, based on SEQRES records:

>d4q2od_ b.36.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mphsvtlrgpspwgfrlvggrdfsapltisrvhagskaalaalcpgdliqaingestelm
thleaqnrikgchdhltlsvsrpeaagggvespwl

Sequence, based on observed residues (ATOM records):

>d4q2od_ b.36.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mphsvtlrgpspwgfrlvggpltisrvhagskaalaalcpgdliqaingestelmthlea
qnrikgchdhltlsvsrpvespwl

Timeline for d4q2od_:

• d4q2od_ is new in SCOPe 2.04-stable
  
• d4q2od_ appears in SCOPe 2.05
  
• d4q2od_ appears in the current release, SCOPe 2.08