![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
![]() | Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins) automatically mapped to Pfam PF00576 |
![]() | Protein Transthyretin (synonym: prealbumin) [49474] (5 species) sandwich; 8 strands in 2 sheets |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries) Uniprot P02766 31-143 |
![]() | Domain d4pwia_: 4pwi A: [261251] automated match to d1ttca_ complexed with roa; mutant |
PDB Entry: 4pwi (more details), 1.49 Å
SCOPe Domain Sequences for d4pwia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pwia_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]} cplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiy kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
Timeline for d4pwia_: