Lineage for d4pkwa1 (4pkw A:266-550)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558127Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2558128Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2558129Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2558271Protein automated matches [190133] (6 species)
    not a true protein
  7. 2558272Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234339] (15 PDB entries)
  8. 2558274Domain d4pkwa1: 4pkw A:266-550 [261244]
    Other proteins in same PDB: d4pkwa2
    automated match to d1j7na3
    complexed with edo, gm6, gol, zn

Details for d4pkwa1

PDB Entry: 4pkw (more details), 1.75 Å

PDB Description: anthrax toxin lethal factor with bound small molecule inhibitor gm6001
PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d4pkwa1:

Sequence, based on SEQRES records: (download)

>d4pkwa1 d.166.1.1 (A:266-550) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
sryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqid
ssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldiqp
ydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmninn
ltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwriql
spdtragylengklilqrnigleikdvqiikqsekeyiridakvv

Sequence, based on observed residues (ATOM records): (download)

>d4pkwa1 d.166.1.1 (A:266-550) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
sryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqid
ssdflsteekeflkklqidirdlsekekeflkklkldiqpydinqrlqdtgglidspsin
ldvrkqykrdiqnidallhqsigstlynkiylyenmninnltatlgadlvdstdntkinr
gifnefkknfkysissnymivdinerpaldnerlkwriqlspdtragylengklilqrni
gleikdvqiikqsekeyiridakvv

SCOPe Domain Coordinates for d4pkwa1:

Click to download the PDB-style file with coordinates for d4pkwa1.
(The format of our PDB-style files is described here.)

Timeline for d4pkwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pkwa2