SCOPe 2.08: Domain d4phtx2: 4pht X:146-235

Lineage for d4phtx2 (4pht X:146-235)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:216895] [261241] (1 PDB entry)

8. Domain d4phtx2: 4pht X:146-235 [261243]
   automated match to d1yf5l1
   complexed with anp, mg, zn

Details for d4phtx2

PDB Entry: 4pht, 2.83 Å

PDB Description: atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system

PDB Compounds: (X:) type II secretion system protein l

SCOPe Domain Sequences for d4phtx2:

Sequence, based on SEQRES records:

>d4phtx2 c.55.1.0 (X:146-235) automated matches {Vibrio vulnificus [TaxId: 216895]}
degisaaqlgeqwlfrhsacqgsavddswmpvylnalageqplsvacfsslpeqqgqahw
lsrpvemtmallsqgvadgkfslltgefkp

Sequence, based on observed residues (ATOM records):

>d4phtx2 c.55.1.0 (X:146-235) automated matches {Vibrio vulnificus [TaxId: 216895]}
degisaaqlgeqwlfrhsacqgsavddswmpvylnsvacfsslpeqqahwlsrpvemtma
llsqgvadgkfslltgefkp

Timeline for d4phtx2:

• d4phtx2 first appeared in SCOPe 2.04
  
• d4phtx2 appears in SCOPe 2.07