SCOPe 2.08: Domain d4p8ob_: 4p8o B:

Lineage for d4p8ob_ (4p8o B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (22 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries)

8. Domain d4p8ob_: 4p8o B: [261238]
   automated match to d3ttzb_
   complexed with 883

Details for d4p8ob_

PDB Entry: 4p8o, 2.4 Å

PDB Description: s. aureus gyrase bound to an aminobenzimidazole urea inhibitor

PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d4p8ob_:

Sequence; same for both SEQRES and ATOM records:

>d4p8ob_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdng
rgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevg
ttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvreds
yhye

Timeline for d4p8ob_:

• d4p8ob_ first appeared in SCOPe 2.04
  
• d4p8ob_ appears in SCOPe 2.07