Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
Protein automated matches [190399] (9 species) not a true protein |
Species Citrobacter freundii [TaxId:546] [261234] (1 PDB entry) |
Domain d4omaa_: 4oma A: [261236] automated match to d3mkja_ complexed with cl, lcs, peg, pge |
PDB Entry: 4oma (more details), 1.6 Å
SCOPe Domain Sequences for d4omaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4omaa_ c.67.1.3 (A:) automated matches {Citrobacter freundii [TaxId: 546]} sdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytrl gnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafls hsmpkfginvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqgal lvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkdi tggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyel gqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvape erlkagitdglirlsvgledpediindlehairkat
Timeline for d4omaa_: