SCOPe 2.04: Domain d4onta_: 4ont A:

Lineage for d4onta_ (4ont A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.4: Complement components [48251] (4 proteins)
   probably related to other families, but has no known enzymatic activity

6. Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48253] (15 PDB entries)

8. Domain d4onta_: 4ont A: [261235]
   automated match to d1ghqa_
   complexed with gol

Details for d4onta_

PDB Entry: 4ont, 2.15 Å

PDB Description: ternary host recognition complex of complement factor h, c3d, and sialic acid

PDB Compounds: (A:) complement c3d fragment

SCOPe Domain Sequences for d4onta_:

Sequence; same for both SEQRES and ATOM records:

>d4onta_ a.102.4.4 (A:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
efrdaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkg
ytqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekq
kpdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitka
gdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynvea
tsyallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

Timeline for d4onta_:

• d4onta_ is new in SCOPe 2.04-stable
  
• d4onta_ appears in SCOPe 2.05
  
• d4onta_ appears in the current release, SCOPe 2.08, called d4onta1