Lineage for d4ob3b_ (4ob3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783802Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
    contains irregular array of helices in the N-terminal extension
    automatically mapped to Pfam PF02211
  6. 2783846Protein automated matches [190606] (3 species)
    not a true protein
  7. 2783851Species Pseudonocardia thermophila [TaxId:1848] [229020] (5 PDB entries)
  8. 2783856Domain d4ob3b_: 4ob3 B: [261230]
    Other proteins in same PDB: d4ob3a1, d4ob3a2
    automated match to d1ireb_
    complexed with co, gol

Details for d4ob3b_

PDB Entry: 4ob3 (more details), 1.92 Å

PDB Description: crystal structure of nitrile hydratase from pseudonocardia thermophila : a reference structure to boronic acid inhibition of nitrile hydratase
PDB Compounds: (B:) Cobalt-containing nitrile hydratase subunit beta

SCOPe Domain Sequences for d4ob3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ob3b_ b.34.4.4 (B:) automated matches {Pseudonocardia thermophila [TaxId: 1848]}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdtk

SCOPe Domain Coordinates for d4ob3b_:

Click to download the PDB-style file with coordinates for d4ob3b_.
(The format of our PDB-style files is described here.)

Timeline for d4ob3b_: