Lineage for d4ob1a_ (4ob1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987858Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2987859Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2987860Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2987880Protein automated matches [190256] (6 species)
    not a true protein
  7. 2987908Species Pseudonocardia thermophila [TaxId:1848] [261227] (4 PDB entries)
  8. 2987911Domain d4ob1a_: 4ob1 A: [261229]
    Other proteins in same PDB: d4ob1b_
    automated match to d1ugpa_
    complexed with bub, co

Details for d4ob1a_

PDB Entry: 4ob1 (more details), 1.63 Å

PDB Description: crystal structure of nitrile hydratase from pseudonocardia thermophila bound to butaneboronic acid via co-crystallization
PDB Compounds: (A:) Cobalt-containing nitrile hydratase subunit alpha

SCOPe Domain Sequences for d4ob1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ob1a_ d.149.1.1 (A:) automated matches {Pseudonocardia thermophila [TaxId: 1848]}
tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlcscypwpvlgl
ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
seeelatlvtresmigvepakav

SCOPe Domain Coordinates for d4ob1a_:

Click to download the PDB-style file with coordinates for d4ob1a_.
(The format of our PDB-style files is described here.)

Timeline for d4ob1a_: