Lineage for d4ob3a1 (4ob3 A:2-204)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224127Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2224128Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2224129Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2224149Protein automated matches [190256] (6 species)
    not a true protein
  7. 2224177Species Pseudonocardia thermophila [TaxId:1848] [261227] (4 PDB entries)
  8. 2224181Domain d4ob3a1: 4ob3 A:2-204 [261228]
    Other proteins in same PDB: d4ob3a2, d4ob3b_
    automated match to d1ugpa_
    complexed with co, gol

Details for d4ob3a1

PDB Entry: 4ob3 (more details), 1.92 Å

PDB Description: crystal structure of nitrile hydratase from pseudonocardia thermophila : a reference structure to boronic acid inhibition of nitrile hydratase
PDB Compounds: (A:) Cobalt-containing nitrile hydratase subunit alpha

SCOPe Domain Sequences for d4ob3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ob3a1 d.149.1.1 (A:2-204) automated matches {Pseudonocardia thermophila [TaxId: 1848]}
tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlcscypwpvlgl
ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
seeelatlvtresmigvepakav

SCOPe Domain Coordinates for d4ob3a1:

Click to download the PDB-style file with coordinates for d4ob3a1.
(The format of our PDB-style files is described here.)

Timeline for d4ob3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ob3a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4ob3b_