Lineage for d4o1la_ (4o1l A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137473Family c.72.1.1: Ribokinase-like [53614] (10 protein domains)
    automatically mapped to Pfam PF00294
  6. 2137495Protein Adenosine kinase [53617] (3 species)
  7. 2137496Species Human (Homo sapiens) [TaxId:9606] [53618] (4 PDB entries)
  8. 2137504Domain d4o1la_: 4o1l A: [261226]
    automated match to d2i6aa_
    complexed with ho4, mg

Details for d4o1la_

PDB Entry: 4o1l (more details), 2.5 Å

PDB Description: Human Adenosine Kinase in complex with inhibitor
PDB Compounds: (A:) adenosine kinase

SCOPe Domain Sequences for d4o1la_:

Sequence, based on SEQRES records: (download)

>d4o1la_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]}
lrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyhag
gstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgtc
aacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkva
hhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdike
iakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdafv
ggflsqlvsdkplteciraghyaasiii

Sequence, based on observed residues (ATOM records): (download)

>d4o1la_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]}
lrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyhag
gstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgtc
aacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkva
hhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdike
iakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkidtngagdafvgg
flsqlvsdkplteciraghyaasiii

SCOPe Domain Coordinates for d4o1la_:

Click to download the PDB-style file with coordinates for d4o1la_.
(The format of our PDB-style files is described here.)

Timeline for d4o1la_: