Lineage for d4nqga_ (4nqg A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733796Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1734343Protein automated matches [190064] (20 species)
    not a true protein
  7. 1734425Species Mitrocoma cellularia [TaxId:31874] [261220] (1 PDB entry)
  8. 1734426Domain d4nqga_: 4nqg A: [261221]
    automated match to d4n1ga_
    complexed with czh

Details for d4nqga_

PDB Entry: 4nqg (more details), 1.3 Å

PDB Description: Crystal Structure of Ca(2+)-regulated photoprotein mitrocomin from Jellyfish Mitrocoma cellularia at 1.3 Angstrom resolution
PDB Compounds: (A:) Mitrocomin

SCOPe Domain Sequences for d4nqga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nqga_ a.39.1.5 (A:) automated matches {Mitrocoma cellularia [TaxId: 31874]}
smgsryavkldtdfdnpkwiarhkhmfnfldinsngqinlnemvhkasniickklgatee
qtrrhqkcvedffggagleydkdttwpeyiegwkrlaktelerhsknrvtlirlwgdalf
diidkdgngsvsldewiqythcagiqqsrgqceatfahcdldgdgkldvdemtrqhlgfw
ysvdstceglyggavpy

SCOPe Domain Coordinates for d4nqga_:

Click to download the PDB-style file with coordinates for d4nqga_.
(The format of our PDB-style files is described here.)

Timeline for d4nqga_: