Lineage for d4cmyf_ (4cmy F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991631Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1991632Protein automated matches [190036] (39 species)
    not a true protein
  7. 1991708Species Chlorobaculum tepidum [TaxId:1097] [261204] (1 PDB entry)
  8. 1991714Domain d4cmyf_: 4cmy F: [261205]
    automated match to d1krqa_
    complexed with fe

Details for d4cmyf_

PDB Entry: 4cmy (more details), 2.59 Å

PDB Description: chlorobium tepidum ferritin
PDB Compounds: (F:) Ferritin

SCOPe Domain Sequences for d4cmyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cmyf_ a.25.1.0 (F:) automated matches {Chlorobaculum tepidum [TaxId: 1097]}
mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv

SCOPe Domain Coordinates for d4cmyf_:

Click to download the PDB-style file with coordinates for d4cmyf_.
(The format of our PDB-style files is described here.)

Timeline for d4cmyf_: