Lineage for d4c27a_ (4c27 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005985Species Trypanosoma cruzi [TaxId:5693] [196511] (10 PDB entries)
  8. 2005986Domain d4c27a_: 4c27 A: [261203]
    automated match to d3khma_
    complexed with 26n, cl, edo, hem

Details for d4c27a_

PDB Entry: 4c27 (more details), 1.95 Å

PDB Description: crystal structure of trypanosoma cruzi cyp51 bound to the inhibitor (r)-n-(3-(1h-indol-3-yl)-1-oxo-1-(pyridin-4-ylamino)propan-2-yl)-2- fluoro-4-(4-(4-(trifluoromethyl)phenyl)piperazin-1-yl)benzamide
PDB Compounds: (A:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d4c27a_:

Sequence, based on SEQRES records: (download)

>d4c27a_ a.104.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ptdppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsr
ffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
evrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmessl
ipaavfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllka
vyrdgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpa
qlnydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllsh
hdeeafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqll
rdevpdpdyhtmvvgptlnqclvkytrkkk

Sequence, based on observed residues (ATOM records): (download)

>d4c27a_ a.104.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ptdppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsr
ffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
evrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmessl
ipaavfmpwllrlplpqsarcrearaelqkilgeiivarekeetsdllggllkavyrdgt
rmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqlnydn
vmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhdeeaf
pnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrdevpd
pdyhtmvvgptlnqclvkytrkkk

SCOPe Domain Coordinates for d4c27a_:

Click to download the PDB-style file with coordinates for d4c27a_.
(The format of our PDB-style files is described here.)

Timeline for d4c27a_: