![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Microbulbifer thermotolerans [TaxId:252514] [261195] (1 PDB entry) |
![]() | Domain d3wz1a_: 3wz1 A: [261196] automated match to d1o4ya_ complexed with gol, na |
PDB Entry: 3wz1 (more details), 1.6 Å
SCOPe Domain Sequences for d3wz1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wz1a_ b.29.1.0 (A:) automated matches {Microbulbifer thermotolerans [TaxId: 252514]} aadwdgvpvpanpgsgktwelhplsddfnyeapaagkstrfyerwkegfinpwtgpglte whphysyvsggklaitsgrkpgtnqvylgsitskapltypvymearaklsnmvlasdfwf lsadsteeidvieaygsdrpgqewyaerlhlshhvfirdpfqdyqptdagswyadgkgtk wrdafhrvgvywrdpwhleyyvdgklvrtvsgqdiidpngftggtglskpmyaiinmedq nwrsdngitptdaeladpnrntyyvdwvrfykpvpin
Timeline for d3wz1a_: