Lineage for d3wymb_ (3wym B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737203Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)
  8. 2737381Domain d3wymb_: 3wym B: [261192]
    automated match to d4lm1a_
    complexed with 3k9, mg, zn

Details for d3wymb_

PDB Entry: 3wym (more details), 2 Å

PDB Description: crystal structure of the catalytic domain of pde10a complexed with 1- (2-fluoro-4-(1h-pyrazol-1-yl)phenyl)-5-methoxy-3-(1-phenyl-1h- pyrazol-5-yl)pyridazin-4(1h)-one
PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d3wymb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wymb_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfims
vkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsy
lqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatd
lalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiya
efwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllka
crdnlsqwekvirge

SCOPe Domain Coordinates for d3wymb_:

Click to download the PDB-style file with coordinates for d3wymb_.
(The format of our PDB-style files is described here.)

Timeline for d3wymb_: