SCOPe 2.07: Domain d3wn5f2: 3wn5 F:84-172

Lineage for d3wn5f2 (3wn5 F:84-172)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries)
   Uniprot O75015 23-189

8. Domain d3wn5f2: 3wn5 F:84-172 [261183]
   Other proteins in same PDB: d3wn5a1, d3wn5a2, d3wn5b1, d3wn5b2, d3wn5d1, d3wn5d2, d3wn5e1, d3wn5e2
   automated match to d1fnla2
   complexed with iod, nag

Details for d3wn5f2

PDB Entry: 3wn5, 2.78 Å

PDB Description: crystal structure of asymmetrically engineered fc variant in complex with fcgriiia

PDB Compounds: (F:) Low affinity immunoglobulin gamma Fc region receptor III-A

SCOPe Domain Sequences for d3wn5f2:

Sequence; same for both SEQRES and ATOM records:

>d3wn5f2 b.1.1.4 (F:84-172) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkgrkyfhhnsdfyipkatl
kdsgsyfcrglvgsknvssetvqititqg

Timeline for d3wn5f2:

• d3wn5f2 first appeared in SCOPe 2.04
  
• d3wn5f2 appears in SCOPe 2.06
  
• d3wn5f2 appears in the current release, SCOPe 2.08