Lineage for d4wk5a1 (4wk5 A:1-268)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2011034Species Thermotoga neapolitana [TaxId:309803] [261178] (1 PDB entry)
  8. 2011035Domain d4wk5a1: 4wk5 A:1-268 [261179]
    Other proteins in same PDB: d4wk5a2
    automated match to d3ts7a_

Details for d4wk5a1

PDB Entry: 4wk5 (more details), 1.7 Å

PDB Description: crystal structure of a isoprenoid synthase family member from thermotoga neapolitana dsm 4359, target efi-509458
PDB Compounds: (A:) Geranyltranstransferase

SCOPe Domain Sequences for d4wk5a1:

Sequence, based on SEQRES records: (download)

>d4wk5a1 a.128.1.0 (A:1-268) automated matches {Thermotoga neapolitana [TaxId: 309803]}
mkketierrieelvkphfnlltesamqysvtaggkrirpllvltvgedigveeerlvdva
vavelfhtaslvhddlppidnadfrrgkpschraygegiallagdglfflafsqiakvre
pklfeefsetayklllgeamdveferqekeisvemvekmysfktgalfafcfsapfllkg
ldhtfvkklgekfgvafqiyddlkdvlgsleklgkdvgkdvkkvtlvkkmgvqkakqlad
kyyeevlealeseglhrtfdflrnlkkm

Sequence, based on observed residues (ATOM records): (download)

>d4wk5a1 a.128.1.0 (A:1-268) automated matches {Thermotoga neapolitana [TaxId: 309803]}
mkketierrieelvkphfnlltesamqysvtaggkrirpllvltvgedigveeerlvdva
vavelfhtaslvhddlppidnadfrrgkpschraygegiallagdglfflafsqiakvre
pklfeefsetayklllgeamdveferqekeisvemvekmysfktgalfafcfsapfllkg
ldhtfvkklgekfgvafqiyddlkdvlgskvtlvkkmgvqkakqladkyyeevlealese
glhrtfdflrnlkkm

SCOPe Domain Coordinates for d4wk5a1:

Click to download the PDB-style file with coordinates for d4wk5a1.
(The format of our PDB-style files is described here.)

Timeline for d4wk5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wk5a2