Lineage for d4wg2b_ (4wg2 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005023Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 2005024Species Bacillus megaterium [TaxId:1404] [48269] (76 PDB entries)
    Uniprot P14779
  8. 2005151Domain d4wg2b_: 4wg2 B: [261177]
    Other proteins in same PDB: d4wg2a2
    automated match to d4kpaa_
    complexed with hem, so4

Details for d4wg2b_

PDB Entry: 4wg2 (more details), 2.66 Å

PDB Description: p411bm3-cis t438s i263f regioselective c-h amination catalyst
PDB Compounds: (B:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d4wg2b_:

Sequence, based on SEQRES records: (download)

>d4wg2b_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfardfagdglvtswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievsedmtrltldtiglcgfnyrfnsfyrdqphpfiismvrald
evmnklqranpddpaydenkrqfqedikvmndlvdkiiadrkargeqsddlltqmlngkd
petgeplddgniryqiitflfagheatsgllsfalyflvknphvlqkvaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdevmvlipqlhr
dktvwgddveefrperfenpsaipqhafkpfgngqrasigqqfalheatlvlgmmlkhfd
fedhtnyeldiketlslkpkgfvvkakskkiplggi

Sequence, based on observed residues (ATOM records): (download)

>d4wg2b_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfardfagdglvtswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievsedmtrltldtiglcgfnyrfnsfyrdqphpfiismvrald
evmnklqranpaydenkrqfqedikvmndlvdkiiadrkaeqsddlltqmlngkdpetge
plddgniryqiitflfagheatsgllsfalyflvknphvlqkvaeeaarvlvdpvpsykq
vkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdevmvlipqlhrdktvw
gddveefrperfenpsaipqhafkpfgngqrasigqqfalheatlvlgmmlkhfdfedht
nyeldiketlslkpkgfvvkakskkiplggi

SCOPe Domain Coordinates for d4wg2b_:

Click to download the PDB-style file with coordinates for d4wg2b_.
(The format of our PDB-style files is described here.)

Timeline for d4wg2b_: