Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (96 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [255698] (5 PDB entries) |
Domain d4v0kb_: 4v0k B: [261175] automated match to d2gaoa1 complexed with cd, gdp |
PDB Entry: 4v0k (more details), 1.44 Å
SCOPe Domain Sequences for d4v0kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v0kb_ c.37.1.0 (B:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} kvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdmsgagry rtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkdlpvam ppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
Timeline for d4v0kb_: