Lineage for d4umxa_ (4umx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905990Protein automated matches [190072] (22 species)
    not a true protein
  7. 2906062Species Human (Homo sapiens) [TaxId:9606] [189131] (10 PDB entries)
  8. 2906068Domain d4umxa_: 4umx A: [261171]
    automated match to d4l03c_
    complexed with gol, nap, vvs

Details for d4umxa_

PDB Entry: 4umx (more details), 1.88 Å

PDB Description: idh1 r132h in complex with cpd 1
PDB Compounds: (A:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d4umxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4umxa_ c.77.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
gwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt
veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev
sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl

SCOPe Domain Coordinates for d4umxa_:

Click to download the PDB-style file with coordinates for d4umxa_.
(The format of our PDB-style files is described here.)

Timeline for d4umxa_: