Lineage for d4u4xa_ (4u4x A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1624950Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)
  6. 1625171Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 1625180Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (124 PDB entries)
  8. 1625218Domain d4u4xa_: 4u4x A: [261170]
    automated match to d4iy6a_
    complexed with 3c2, act, glu, gol, peg, so4

Details for d4u4xa_

PDB Entry: 4u4x (more details), 1.56 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j-l483y- n754s) in complex with glutamate and bpam37 at 1.56 a resolution.
PDB Compounds: (A:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d4u4xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u4xa_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
ygardadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtp
iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
lseqglldklknkwwydkgecgs

SCOPe Domain Coordinates for d4u4xa_:

Click to download the PDB-style file with coordinates for d4u4xa_.
(The format of our PDB-style files is described here.)

Timeline for d4u4xa_: