| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (2 families) ![]() |
| Family b.1.15.0: automated matches [233856] (1 protein) not a true family |
| Protein automated matches [233857] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries) |
| Domain d4um9a2: 4um9 A:439-594 [261168] Other proteins in same PDB: d4um9a1, d4um9c1 automated match to d1m1xa1 complexed with ca, man, mg, nag, so4 |
PDB Entry: 4um9 (more details), 2.5 Å
SCOPe Domain Sequences for d4um9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4um9a2 b.1.15.0 (A:439-594) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif
meyrldyrtaadttglqpilnqftpanisrqahill
Timeline for d4um9a2: