SCOPe 2.05: Domain d4rnrb1: 4rnr B:3-107

Lineage for d4rnrb1 (4rnr B:3-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4rnrb1: 4rnr B:3-107 [261160]
   Other proteins in same PDB: d4rnrb2, d4rnrd2
   automated match to d1aqkl1
   complexed with nag

Details for d4rnrb1

PDB Entry: 4rnr, 2.76 Å

PDB Description: crystal structure of broadly neutralizing anti-hiv antibody pgt130

PDB Compounds: (B:) PGT130 Light Chain

SCOPe Domain Sequences for d4rnrb1:

Sequence; same for both SEQRES and ATOM records:

>d4rnrb1 b.1.1.0 (B:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqppsasgslgqsvtiscngtssdiggwnfvswyqqfpgraprliifevnkrpsgvpg
rfsgsksgnsasltvsglqsddegqyfcsslfgrwdvvfgggtkltvlg

Timeline for d4rnrb1:

• d4rnrb1 first appeared in SCOPe 2.04
  
• d4rnrb1 appears in SCOPe 2.06
  
• d4rnrb1 appears in the current release, SCOPe 2.08