SCOPe 2.08: Domain d4rqqa2: 4rqq A:107-212

Lineage for d4rqqa2 (4rqq A:107-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4rqqa2: 4rqq A:107-212 [261159]
   Other proteins in same PDB: d4rqqa1, d4rqqb_, d4rqqc1, d4rqqd_, d4rqqh_, d4rqql1
   automated match to d1dn0a2

Details for d4rqqa2

PDB Entry: 4rqq, 3.1 Å

PDB Description: Crystal structure of human Fab PGDM1400, a broadly reactive and potent HIV-1 neutralizing antibody

PDB Compounds: (A:) Human anti-HIV-1 antibody PGDM1400 light chain

SCOPe Domain Sequences for d4rqqa2:

Sequence; same for both SEQRES and ATOM records:

>d4rqqa2 b.1.1.2 (A:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d4rqqa2:

• d4rqqa2 first appeared in SCOPe 2.04
  
• d4rqqa2 appears in SCOPe 2.07