Lineage for d4rqqa2 (4rqq A:107-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752137Domain d4rqqa2: 4rqq A:107-212 [261159]
    Other proteins in same PDB: d4rqqa1, d4rqqb_, d4rqqc1, d4rqqd_, d4rqqh_, d4rqql1
    automated match to d1dn0a2

Details for d4rqqa2

PDB Entry: 4rqq (more details), 3.1 Å

PDB Description: Crystal structure of human Fab PGDM1400, a broadly reactive and potent HIV-1 neutralizing antibody
PDB Compounds: (A:) Human anti-HIV-1 antibody PGDM1400 light chain

SCOPe Domain Sequences for d4rqqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rqqa2 b.1.1.2 (A:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d4rqqa2:

Click to download the PDB-style file with coordinates for d4rqqa2.
(The format of our PDB-style files is described here.)

Timeline for d4rqqa2: