SCOPe 2.08: Domain d4rqqc1: 4rqq C:3-106

Lineage for d4rqqc1 (4rqq C:3-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4rqqc1: 4rqq C:3-106 [261156]
   Other proteins in same PDB: d4rqqa2, d4rqqc2, d4rqql2
   automated match to d1dn0a1

Details for d4rqqc1

PDB Entry: 4rqq, 3.1 Å

PDB Description: Crystal structure of human Fab PGDM1400, a broadly reactive and potent HIV-1 neutralizing antibody

PDB Compounds: (C:) Human anti-HIV-1 antibody PGDM1400 light chain

SCOPe Domain Sequences for d4rqqc1:

Sequence; same for both SEQRES and ATOM records:

>d4rqqc1 b.1.1.0 (C:3-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqsphslsvtpgesasiscksshslihgdrnnylawyvqkpgrspqlliylassrasg
vpdrfsgsgsdkdftlkisrvetedvgtyycmqgrespwtfgqgtkvdi

Timeline for d4rqqc1:

• d4rqqc1 first appeared in SCOPe 2.04
  
• d4rqqc1 appears in SCOPe 2.07