Lineage for d4rdud_ (4rdu D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692777Species Human (Homo sapiens) [TaxId:9606] [189258] (28 PDB entries)
  8. 2692781Domain d4rdud_: 4rdu D: [261145]
    automated match to d1ftta_
    protein/DNA complex

Details for d4rdud_

PDB Entry: 4rdu (more details), 1.85 Å

PDB Description: crystal structure of a distal-less homeobox protein 5 (dlx5) from homo sapiens at 1.85 a resolution
PDB Compounds: (D:) Homeobox protein DLX-5

SCOPe Domain Sequences for d4rdud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rdud_ a.4.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrkprtiyssfqlaalqrrfqktqylalperaelaaslgltqtqvkiwfqnkrskikkim
kn

SCOPe Domain Coordinates for d4rdud_:

Click to download the PDB-style file with coordinates for d4rdud_.
(The format of our PDB-style files is described here.)

Timeline for d4rdud_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4rdua_