SCOPe 2.08: Domain d4r9ua_: 4r9u A:

Lineage for d4r9ua_ (4r9u A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.22: ABC transporter involved in vitamin B12 uptake, BtuC [81346] (1 superfamily)
   multihelical; complex architecture with several transmembrane helices

4. Superfamily f.22.1: ABC transporter involved in vitamin B12 uptake, BtuC [81345] (1 family)
   automatically mapped to Pfam PF01032

5. Family f.22.1.1: ABC transporter involved in vitamin B12 uptake, BtuC [75648] (2 proteins)

6. Protein automated matches [261138] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [261139] (1 PDB entry)

8. Domain d4r9ua_: 4r9u A: [261140]
   Other proteins in same PDB: d4r9uc_, d4r9ud_
   automated match to d2qi9a_
   complexed with anp, lda, mg

Details for d4r9ua_

PDB Entry: 4r9u, 2.79 Å

PDB Description: Structure of vitamin B12 transporter BtuCD in a nucleotide-bound outward facing state

PDB Compounds: (A:) Vitamin B12 import system permease protein btuC

SCOPe Domain Sequences for d4r9ua_:

Sequence; same for both SEQRES and ATOM records:

>d4r9ua_ f.22.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
mltlarqqqrqnirwllslsvlmllalllslsageqwispgdwftprgelfvwqirlprt
lavllvgaalaisgavmqalfenplaepgllgvsngagvgliaavllgqgqlpnwalgls
aiagaliitlillrfarrhlstsrlllagvalgiissalmtwaiyfstsvdlrqlmywmm
ggfggvdwrqswlmlalipvllwissqsrpmnmlalgeisarqlglplwfwrnvlvaatg
wmvgvsvalagaigfiglviphilrlsgltdhrvllpgcalagasallladivarlalaa
aelpigvvtatlgapvfiwlllka

Timeline for d4r9ua_:

• d4r9ua_ first appeared in SCOPe 2.04
  
• d4r9ua_ appears in SCOPe 2.07